Recombinant Human Munc18c protein (ab159609)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCK MTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSE NKYRAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTR DVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKP LDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLH ELTFQAMAYDLLPIENDTYKYKTDGKEKEAILEEEDDLWVRIRHRHIAVV LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNL AEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHD NCDKIRAILLYIFSINGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIV PQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQ CPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEV SQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE
    • Amino acids
      1 to 592
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Munc18 3
    • Munc18 c
    • Platelet Sec1 protein
    • Protein unc-18 homolog 3
    • Protein unc-18 homolog C
    • PSP
    • STXB3_HUMAN
    • STXBP 3
    • STXBP3
    • Sxtbp3
    • syntaxin 4 binding protein
    • Syntaxin binding protein 3
    • Syntaxin-binding protein 3
    • Unc 18 3
    • Unc 18 homolog 3
    • Unc 18c
    • Unc-18C
    • Unc18-3
    see all
  • Function
    Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes.
  • Tissue specificity
    Megakaryocytes and platelets.
  • Sequence similarities
    Belongs to the STXBP/unc-18/SEC1 family.
  • Post-translational
    modifications
    Phosphorylated by PKC in platelets in response to thrombin stimulation; phosphorylation inhibits binding to STX4.
  • Cellular localization
    Cytoplasm > cytosol. Cell membrane. In platelets, predominantly cytosolic. Low amounts membrane-associated.
  • Information by UniProt

Images

  • ab159609 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up