Recombinant Human MUPCDH protein (ab162706)

Overview

  • Product name
    Recombinant Human MUPCDH protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGN QLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
    • Amino acids
      27 to 125
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin-related family member 5
    • Cdhr5
    • CDHR5_HUMAN
    • FLJ 20219
    • FLJ20219
    • MU-PCDH
    • Mu-protocadherin
    • MUCDHL
    • MUCDHL-ALT
    • MUCDHL-FL
    • Mucin and cadherin-like protein
    • mucin-like protocadherin
    see all
  • Function
    Acts as a calcium-dependent cell adhesion protein.
  • Tissue specificity
    Highest expression in kidney, liver, colon and small intestine. In kidney, expressed apically along brush border of proximal convoluted tubule but not in cortical collecting ducts. Isoform 1 is expressed primarily in adult small intestine and colon. Isoform 2 is highly expressed in fetal liver.
  • Sequence similarities
    Contains 4 cadherin domains.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162706 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up