Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFE NMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      254 to 352

Specifications

Our Abpromise guarantee covers the use of ab112428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase TRIM63
    • FLJ32380
    • IRF
    • Iris RING finger protein
    • MURF 1
    • MURF-1
    • MuRF1
    • MURF2
    • Muscle specific ring finger protein 1
    • Muscle specific ring finger protein 2
    • Muscle-specific RING finger protein 1
    • OTTHUMP00000008701
    • RING finger protein 28
    • RNF 28
    • RNF28
    • SMRZ
    • Striated muscle RING zinc finger protein
    • TRI63_HUMAN
    • TRIM 63
    • Trim63
    • Tripartite motif containing 63
    • tripartite motif containing 63, E3 ubiquitin protein ligase
    • Tripartite motif containing protein 63
    • Tripartite motif-containing protein 63
    • Ubiquitin ligase TRIM63
    see all
  • Function
    E3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric-associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.
  • Tissue specificity
    Muscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 B box-type zinc finger.
    Contains 1 COS domain.
    Contains 1 RING-type zinc finger.
  • Developmental stage
    Expressed throughout all developmental stages.
  • Domain
    The RING-type zinc finger mediates interaction with SUMO2 and localization to the nucleus. Also required for the E3 ubiquitin ligase activity.
  • Cellular localization
    Cytoplasm. Nucleus. Localizes to the M- and Z-lines in skeletal muscle. Colocalizes with TNNI3 in myocytes.
  • Information by UniProt

Images

  • ab112428 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up