Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ969Q1
    • SpeciesHuman
    • SequenceMDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAND IFQAANPYWTSRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVEN IIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGI HKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKE NSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQ EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE GHQ
    • Molecular weight40 kDa
    • Amino acids1 to 353

Specifications

Our Abpromise guarantee covers the use of ab125750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityTypical enzyme concentration of 100 nM - 5 mM is used for in vitro conjugation, depending on conditions.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Additional notes Typical enzyme concentration of 100 nM - 5 mM is used for in vitro conjugation, depending on conditions.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.6% Tris, 10% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase TRIM63
    • FLJ32380
    • IRF
    • Iris RING finger protein
    • MURF 1
    • MURF-1
    • MuRF1
    • MURF2
    • Muscle specific ring finger protein 1
    • Muscle specific ring finger protein 2
    • Muscle-specific RING finger protein 1
    • OTTHUMP00000008701
    • RING finger protein 28
    • RNF 28
    • RNF28
    • SMRZ
    • Striated muscle RING zinc finger protein
    • TRI63_HUMAN
    • TRIM 63
    • Trim63
    • Tripartite motif containing 63
    • tripartite motif containing 63, E3 ubiquitin protein ligase
    • Tripartite motif containing protein 63
    • Tripartite motif-containing protein 63
    • Ubiquitin ligase TRIM63
    see all
  • FunctionE3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric-associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.
  • Tissue specificityMuscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 B box-type zinc finger.
    Contains 1 COS domain.
    Contains 1 RING-type zinc finger.
  • Developmental stageExpressed throughout all developmental stages.
  • DomainThe RING-type zinc finger mediates interaction with SUMO2 and localization to the nucleus. Also required for the E3 ubiquitin ligase activity.
  • Cellular localizationCytoplasm. Nucleus. Localizes to the M- and Z-lines in skeletal muscle. Colocalizes with TNNI3 in myocytes.
  • Information by UniProt

References for Recombinant human MURF1 protein (ab125750)

ab125750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"