Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPA SLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGP
    • Amino acids
      452 to 549
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Crossover junction endonuclease MUS81
    • FLJ21012
    • FLJ44872
    • Mus 81
    • MUS81
    • MUS81 Endonuclease Homolog
    • MUS81_HUMAN
    see all
  • Function
    Interacts with EME1 and EME2 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the XPF family.
    Contains 1 ERCC4 domain.
  • Developmental stage
    Expressed in S phase and G2 phase.
  • Cellular localization
    Nucleus > nucleolus. Recruited to foci of DNA damage in S-phase cells.
  • Information by UniProt

Images

  • ab153521 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up