Recombinant Human Mutarotase protein (ab98150)

Overview

  • Product name
    Recombinant Human Mutarotase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLR VDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVA NRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFS RISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVEL GKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEE YDHTTWFKFSVA
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 342
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab98150 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Aldose 1 epimerase
    • Aldose 1-epimerase
    • BLOCK25 protein
    • galactomutarotase
    • galactose mutarotase (aldose 1-epimerase)
    • Galactose mutarotase
    • Galm
    • GALM_HUMAN
    see all
  • Function
    Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.
  • Pathway
    Carbohydrate metabolism; hexose metabolism.
  • Sequence similarities
    Belongs to the aldose epimerase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Mutarotase protein images

  • 15% SDS-PAGE analysis of 3µg ab98150

References for Recombinant Human Mutarotase protein (ab98150)

ab98150 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up