Recombinant Human Mutarotase protein (ab98150)

Overview

  • Product name
    Recombinant Human Mutarotase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLR VDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVA NRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFS RISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVEL GKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEE YDHTTWFKFSVA
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 342
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab98150 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Aldose 1 epimerase
    • Aldose 1-epimerase
    • BLOCK25 protein
    • galactomutarotase
    • galactose mutarotase (aldose 1-epimerase)
    • Galactose mutarotase
    • Galm
    • GALM_HUMAN
    see all
  • Function
    Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.
  • Pathway
    Carbohydrate metabolism; hexose metabolism.
  • Sequence similarities
    Belongs to the aldose epimerase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98150

References

ab98150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up