Overview

  • Product name
    Recombinant Human MVD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASEKPLAAVTCTAPVNIAVIKYWGKRDEE LVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQ ACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAG YACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAE SVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGF PPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQ ILDDPCAHLLGPDGLPKPAA
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 400
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab116190 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Diphosphomevalonate decarboxylase
    • FP17780
    • MDDase
    • Mevalonate (diphospho) decarboxylase
    • Mevalonate (diphospho)decarboxylase
    • Mevalonate pyrophosphate decarboxylase
    • MPD
    • Mvd
    • MVD1_HUMAN
    see all
  • Function
    Performs the first committed step in the biosynthesis of isoprenes.
  • Tissue specificity
    Expressed in heart, skeletal muscle, lung, liver, brain, pancreas, kidney and placenta.
  • Pathway
    Steroid biosynthesis; cholesterol biosynthesis.
  • Sequence similarities
    Belongs to the diphosphomevalonate decarboxylase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE gel analysis of 3 µg ab116190.

References

ab116190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up