Overview

  • Product nameRecombinant Human MVD protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP53602
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASEKPLAAVTCTAPVNIAVIKYWGKRDEE LVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQ ACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAG YACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAE SVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGF PPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQ ILDDPCAHLLGPDGLPKPAA
    • Molecular weight46 kDa including tags
    • Amino acids1 to 400
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab116190 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Diphosphomevalonate decarboxylase
    • FP17780
    • MDDase
    • Mevalonate (diphospho) decarboxylase
    • Mevalonate (diphospho)decarboxylase
    • Mevalonate pyrophosphate decarboxylase
    • MPD
    • Mvd
    • MVD1_HUMAN
    see all
  • FunctionPerforms the first committed step in the biosynthesis of isoprenes.
  • Tissue specificityExpressed in heart, skeletal muscle, lung, liver, brain, pancreas, kidney and placenta.
  • PathwaySteroid biosynthesis; cholesterol biosynthesis.
  • Sequence similaritiesBelongs to the diphosphomevalonate decarboxylase family.
  • Information by UniProt

Recombinant Human MVD protein images

  • 15% SDS-PAGE gel analysis of 3 µg ab116190.

References for Recombinant Human MVD protein (ab116190)

ab116190 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"