Overview

  • Product name
    Recombinant Human MVD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASEKPLAAVTCTAPVNIAVIKYWGKRDEE LVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQ ACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAG YACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAE SVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGF PPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQ ILDDPCAHLLGPDGLPKPAA
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 400
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab116190 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Diphosphomevalonate decarboxylase
    • FP17780
    • MDDase
    • Mevalonate (diphospho) decarboxylase
    • Mevalonate (diphospho)decarboxylase
    • Mevalonate pyrophosphate decarboxylase
    • MPD
    • Mvd
    • MVD1_HUMAN
    see all
  • Function
    Performs the first committed step in the biosynthesis of isoprenes.
  • Tissue specificity
    Expressed in heart, skeletal muscle, lung, liver, brain, pancreas, kidney and placenta.
  • Pathway
    Steroid biosynthesis; cholesterol biosynthesis.
  • Sequence similarities
    Belongs to the diphosphomevalonate decarboxylase family.
  • Information by UniProt

Recombinant Human MVD protein images

  • 15% SDS-PAGE gel analysis of 3 µg ab116190.

References for Recombinant Human MVD protein (ab116190)

ab116190 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up