Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ03426
    • SpeciesHuman
    • SequenceLIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKP GLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL
    • Molecular weight37 kDa including tags
    • Amino acids297 to 396

Specifications

Our Abpromise guarantee covers the use of ab116772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ96772
    • KIME_HUMAN
    • LH receptor mRNA binding protein
    • LRBP
    • Mevalonate kinase
    • Mevalonate kinase 1
    • Mevalonic aciduria
    • MK
    • mvk
    • MVLK
    • POROK3
    see all
  • FunctionMay be a regulatory site in cholesterol biosynthetic pathway.
  • PathwayIsoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via mevalonate pathway; isopentenyl diphosphate from (R)-mevalonate: step 1/3.
  • Involvement in diseaseDefects in MVK are the cause of mevalonic aciduria (MEVA) [MIM:610377]. It is an accumulation of mevalonic acid which causes a variety of symptoms such as psychomotor retardation, dysmorphic features, cataracts, hepatosplenomegaly, lymphadenopathy, anemia, hypotonia, myopathy, and ataxia.
    Defects in MVK are the cause of hyperimmunoglobulinemia D and periodic fever syndrome (HIDS) [MIM:260920]. HIDS is an autosomal recessive disease characterized by recurrent episodes of unexplained high fever associated with skin rash, diarrhea, adenopathy (swollen, tender lymph nodes), athralgias and/or arthritis. Concentration of IgD, and often IgA, are above normal.
  • Sequence similaritiesBelongs to the GHMP kinase family. Mevalonate kinase subfamily.
  • Cellular localizationCytoplasm. Peroxisome.
  • Information by UniProt

Recombinant Human MVK protein images

  • 12.5% SDS-PAGE showing ab116772 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human MVK protein (ab116772)

ab116772 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"