Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVR PCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSG IVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAI AGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKT LIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPD LVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH QRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEED IRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVN YRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHR TAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKEL EEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARL TQARRRLAQFPG
    • Molecular weight
      99 kDa including tags
    • Amino acids
      1 to 662

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114395 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Human interferon regulated resistance GTP binding protein MXA
    • IFI 78
    • IFI 78K
    • IFI-78K
    • IFI78
    • IFI78K
    • Interferon induced GTP binding protein Mx1
    • Interferon induced protein p78
    • Interferon inducible protein p78
    • Interferon regulated resistance GTP binding protein
    • Interferon regulated resistance GTP binding protein MxA
    • Interferon-induced GTP-binding protein Mx1
    • Interferon-induced protein p78
    • Interferon-regulated resistance GTP-binding protein MxA
    • MX
    • MX 1
    • MX dynamin-like GTPase 1
    • MX1
    • MX1_HUMAN
    • MxA
    • Myxoma resistance protein 1
    • Myxovirus (influenza virus) resistance 1 interferon inducible
    • Myxovirus (influenza virus) resistance 1 interferon inducible protein p78
    • Myxovirus (influenza) resistance 1 homolog of murine
    • Myxovirus resistance 1, mouse, homolog of
    • Myxovirus resistance protein 1
    • N-terminally processed
    see all
  • Function
    May regulate the calcium channel activity of TRPCs. Shows activity against influenza virus and VSV, a rhabdovirus.
  • Sequence similarities
    Belongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114395 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up