Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20591
    • SpeciesHuman
    • SequenceMVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVR PCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSG IVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAI AGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKT LIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPD LVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH QRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEED IRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVN YRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHR TAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKEL EEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARL TQARRRLAQFPG
    • Molecular weight99 kDa including tags
    • Amino acids1 to 662

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114395 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Human interferon regulated resistance GTP binding protein MXA
    • IFI 78
    • IFI 78K
    • IFI-78K
    • IFI78
    • IFI78K
    • Interferon induced GTP binding protein Mx1
    • Interferon induced protein p78
    • Interferon inducible protein p78
    • Interferon regulated resistance GTP binding protein
    • Interferon regulated resistance GTP binding protein MxA
    • Interferon-induced GTP-binding protein Mx1
    • Interferon-induced protein p78
    • Interferon-regulated resistance GTP-binding protein MxA
    • MX
    • MX 1
    • MX dynamin-like GTPase 1
    • MX1
    • MX1_HUMAN
    • MxA
    • Myxoma resistance protein 1
    • Myxovirus (influenza virus) resistance 1 interferon inducible
    • Myxovirus (influenza virus) resistance 1 interferon inducible protein p78
    • Myxovirus (influenza) resistance 1 homolog of murine
    • Myxovirus resistance 1, mouse, homolog of
    • Myxovirus resistance protein 1
    • N-terminally processed
    see all
  • FunctionMay regulate the calcium channel activity of TRPCs. Shows activity against influenza virus and VSV, a rhabdovirus.
  • Sequence similaritiesBelongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human MX1 protein images

  • ab114395 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human MX1 protein (ab114395)

ab114395 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"