Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQL QFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      521 to 620

Specifications

Our Abpromise guarantee covers the use of ab114903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Interferon induced GTP binding protein Mx2
    • Interferon regulated resistance GTP binding protein MXB
    • Interferon-induced GTP-binding protein Mx2
    • Interferon-regulated resistance GTP-binding protein MxB
    • MX 2
    • MX dynamin like GTPase 2
    • Mx2
    • MX2_HUMAN
    • MXB
    • Myxovirus (influenza virus) resistance 2
    • Myxovirus resistance 2
    • Myxovirus resistance protein 2
    • p78 related protein
    • p78-related protein
    • Second interferon induced protein p78
    see all
  • Sequence similarities
    Belongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114903 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up