Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20592
    • SpeciesHuman
    • SequenceQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQL QFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSV
    • Molecular weight37 kDa including tags
    • Amino acids521 to 620

Specifications

Our Abpromise guarantee covers the use of ab114903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Interferon induced GTP binding protein Mx2
    • Interferon regulated resistance GTP binding protein MXB
    • Interferon-induced GTP-binding protein Mx2
    • Interferon-regulated resistance GTP-binding protein MxB
    • MX 2
    • MX dynamin like GTPase 2
    • Mx2
    • MX2_HUMAN
    • MXB
    • Myxovirus (influenza virus) resistance 2
    • Myxovirus resistance 2
    • Myxovirus resistance protein 2
    • p78 related protein
    • p78-related protein
    • Second interferon induced protein p78
    see all
  • Sequence similaritiesBelongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human MX2 protein images

  • 12.5% SDS-PAGE showing ab114903 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MX2 protein (ab114903)

ab114903 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"