Recombinant Human MYBPC1 protein (ab152550)

Overview

  • Product name
    Recombinant Human MYBPC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPP KAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      506 to 603

Specifications

Our Abpromise guarantee covers the use of ab152550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C protein, skeletal muscle slow isoform
    • C-protein
    • MYBPC1
    • MYBPCC
    • MYBPCS
    • Myosin binding protein C, slow type
    • Myosin-binding protein C
    • MYPC1_HUMAN
    • skeletal muscle C protein
    • skeletal muscle slow isoform
    • Slow MyBP C
    • Slow MyBP-C
    • slow-type
    see all
  • Function
    Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. MyBP family.
    Contains 3 fibronectin type-III domains.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152550 stained with Coomassie Blue.

References

ab152550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up