Overview

  • Product nameRecombinant Human MYBPH protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13203
    • SpeciesHuman
    • SequenceMMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAP APQAPTASTATKPAPPSEDVPSAPLLLTLDDVSSSSVTVSWEPPERLGRL GLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSS AGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQG KPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRV EDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG YMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLST SATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQ LFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSG VYTCKAINVLGEASVDCRLEVKASAAH
    • Molecular weight79 kDa including tags
    • Amino acids1 to 477

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe38
    • H protein
    • H-protein
    • l-myc protein
    • l-myc-1 proto-oncogene
    • LMYC
    • MyBP H
    • MyBP-H
    • Mybph
    • MYBPH_HUMAN
    • myc-related gene from lung cancer
    • MYCL
    • Myosin binding protein H
    • Myosin binding protein, 86-KD
    • Myosin-binding protein H
    • Oncogene lmyc
    • V-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived
    see all
  • FunctionBinds to myosin; probably involved in interaction with thick myofilaments in the A-band.
  • Tissue specificitySkeletal muscle.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. MyBP family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt

Recombinant Human MYBPH protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human MYBPH protein (ab114819)

ab114819 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"