Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQG RPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      31 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mutant myeloid differentiation primary response 88
    • MYD 88
    • Myd88
    • MYD88_HUMAN
    • MYD88D
    • Myeloid differentiation marker 88
    • Myeloid differentiation primary response 88
    • Myeloid differentiation primary response gene
    • Myeloid differentiation primary response gene (88)
    • Myeloid differentiation primary response gene 88
    • Myeloid differentiation primary response protein MyD88
    • OTTHUMP00000161718
    • OTTHUMP00000208595
    • OTTHUMP00000209058
    • OTTHUMP00000209059
    • OTTHUMP00000209060
    see all
  • Function
    Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in MYD88 are the cause of MYD88 deficiency (MYD88D) [MIM:612260]; also known as recurrent pyogenic bacterial infections due to MYD88 deficiency. Patients suffer from autosomal recessive, life-threatening, often recurrent pyogenic bacterial infections, including invasive pneumococcal disease, and die between 1 and 11 months of age. Surviving patients are otherwise healthy, with normal resistance to other microbes, and their clinical status improved with age.
  • Sequence similarities
    Contains 1 death domain.
    Contains 1 TIR domain.
  • Domain
    The intermediate domain (ID) is required for the phosphorylation and activation of IRAK.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human MyD88 protein images

  • ab114217 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MyD88 protein (ab114217)

ab114217 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up