Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQG RPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      31 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mutant myeloid differentiation primary response 88
    • MYD 88
    • Myd88
    • MYD88_HUMAN
    • MYD88D
    • Myeloid differentiation marker 88
    • Myeloid differentiation primary response 88
    • Myeloid differentiation primary response gene
    • Myeloid differentiation primary response gene (88)
    • Myeloid differentiation primary response gene 88
    • Myeloid differentiation primary response protein MyD88
    • OTTHUMP00000161718
    • OTTHUMP00000208595
    • OTTHUMP00000209058
    • OTTHUMP00000209059
    • OTTHUMP00000209060
    see all
  • Function
    Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in MYD88 are the cause of MYD88 deficiency (MYD88D) [MIM:612260]; also known as recurrent pyogenic bacterial infections due to MYD88 deficiency. Patients suffer from autosomal recessive, life-threatening, often recurrent pyogenic bacterial infections, including invasive pneumococcal disease, and die between 1 and 11 months of age. Surviving patients are otherwise healthy, with normal resistance to other microbes, and their clinical status improved with age.
  • Sequence similarities
    Contains 1 death domain.
    Contains 1 TIR domain.
  • Domain
    The intermediate domain (ID) is required for the phosphorylation and activation of IRAK.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114217 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up