Recombinant Human Myelin expression factor 2 protein (ab162356)

Overview

  • Product name
    Recombinant Human Myelin expression factor 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMER DFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGP GIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKL KEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISG REIDVRLDRNA
    • Amino acids
      1 to 211
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MYEF2
    • KIAA1341
    • MEF 2
    • MST156
    • MYEF 2
    • Myelin expression factor 2
    see all
  • Relevance
    Myelin expression factor 2 (MEF2) is expressed early in the differentiation program and is suppressed by specific polypeptide growth factors. The ability of MEF2 to recognize conserved activating elements associated with multiple specific genes suggests that this factor may participate in the coordinate regulation of genes during myogenesis.
  • Cellular localization
    Nuclear

Images

  • ab162356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up