Recombinant Human Myeloid zinc finger 1 protein (ab152812)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGP GAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      419 to 518

Specifications

Our Abpromise guarantee covers the use of ab152812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Myeloid zinc finger 1
    • MZF 1
    • MZF-1
    • MZF1
    • MZF1_HUMAN
    • MZF1B
    • Zfp98
    • Zinc finger and SCAN domain containing protein 6
    • Zinc finger and SCAN domain-containing protein 6
    • Zinc finger protein 42
    • ZNF42
    • ZSCAN6
    see all
  • Function
    Binds to target promoter DNA and functions as trancription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.
  • Tissue specificity
    Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 13 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152812 stained with Coomassie Blue.

References

ab152812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up