Recombinant Human Myeloperoxidase protein (ab158915)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA QISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
    • Amino acids
      646 to 745
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 84 kDa myeloperoxidase
    • 89 kDa myeloperoxidase
    • EC 1.11.1.7
    • EC1.11.2.2
    • fj80f04
    • MPO
    • mpx
    • myeloid-specific peroxidase
    • Myeloperoxidase
    • Myeloperoxidase heavy chain
    • Myeloperoxidase light chain
    • PERM_HUMAN
    • wu:fj80f04
    see all
  • Function
    Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity.
  • Involvement in disease
    Defects in MPO are the cause of myeloperoxidase deficiency (MPD) [MIM:254600]. MPD is an autosomal recessive defect that results in disseminated candidiasis.
  • Sequence similarities
    Belongs to the peroxidase family. XPO subfamily.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • ab158915 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up