Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23409
    • SpeciesHuman
    • SequenceMMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPP EAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT
    • Molecular weight37 kDa including tags
    • Amino acids1 to 99

Specifications

Our Abpromise guarantee covers the use of ab114698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHc4
    • Class C basic helix-loop-helix protein 4
    • CNM3
    • HERCULIN
    • MRF4
    • Muscle-regulatory factor 4
    • Muscle-specific regulatory factor 4
    • Myf-6
    • Myf6
    • MYF6_HUMAN
    • Myogenic factor 6
    • myogenic factor 6 (herculin)
    see all
  • FunctionInvolved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
  • Tissue specificitySkeletal muscle.
  • Involvement in diseaseDefects in MYF6 may be a cause of centronuclear myopathy autosomal dominant (ADCNM) [MIM:160150]; also known as autosomal dominant myotubular myopathy. Centronuclear myopathies are congenital muscle disorders characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MYF6 protein images

  • 12.5% SDS-PAGE showing ab114698 at approximately 36.52 kDa stained with Coomassie Blue.

References for Recombinant Human MYF6 protein (ab114698)

ab114698 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"