Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGK PKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTV MGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 197
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALC 1
    • ALC1
    • AMLC
    • Atrial/embryonic alkali myosin light chain
    • embryonic muscle/atrial isoform
    • GT 1
    • GT1
    • MLC 1
    • MLC1
    • MYL 4
    • Myl4
    • MYL4_HUMAN
    • Myosin atrial/fetal muscle light chain
    • Myosin light chain 1
    • Myosin light chain 1 embryonic muscle/atrial isoform
    • Myosin light chain 4
    • Myosin light chain 4 alkali atrial embryonic
    • Myosin light chain alkali GT 1 isoform
    • Myosin light chain alkali GT-1 isoform
    • Myosin light polypeptide 4
    • Myosin light polypeptide 4 alkali atrial embryonic
    • PRO1957
    see all
  • Function
    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114309 on a 12.5% gel stained with Coomassie Blue.

References

ab114309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up