Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12829
    • SpeciesHuman
    • SequenceMAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGK PKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTV MGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
    • Molecular weight47 kDa including tags
    • Amino acids1 to 197
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALC 1
    • ALC1
    • AMLC
    • Atrial/embryonic alkali myosin light chain
    • embryonic muscle/atrial isoform
    • GT 1
    • GT1
    • MLC 1
    • MLC1
    • MYL 4
    • Myl4
    • MYL4_HUMAN
    • Myosin atrial/fetal muscle light chain
    • Myosin light chain 1
    • Myosin light chain 1 embryonic muscle/atrial isoform
    • Myosin light chain 4
    • Myosin light chain 4 alkali atrial embryonic
    • Myosin light chain alkali GT 1 isoform
    • Myosin light chain alkali GT-1 isoform
    • Myosin light polypeptide 4
    • Myosin light polypeptide 4 alkali atrial embryonic
    • PRO1957
    see all
  • FunctionRegulatory light chain of myosin. Does not bind calcium.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MYL4 protein images

  • SDS-PAGE analysis of ab114309 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human MYL4 protein (ab114309)

ab114309 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"