Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGK PKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTV MGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSGLEH HHHHH
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 197
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab115722 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • ALC 1
    • ALC1
    • AMLC
    • Atrial/embryonic alkali myosin light chain
    • embryonic muscle/atrial isoform
    • GT 1
    • GT1
    • MLC 1
    • MLC1
    • MYL 4
    • Myl4
    • MYL4_HUMAN
    • Myosin atrial/fetal muscle light chain
    • Myosin light chain 1
    • Myosin light chain 1 embryonic muscle/atrial isoform
    • Myosin light chain 4
    • Myosin light chain 4 alkali atrial embryonic
    • Myosin light chain alkali GT 1 isoform
    • Myosin light chain alkali GT-1 isoform
    • Myosin light polypeptide 4
    • Myosin light polypeptide 4 alkali atrial embryonic
    • PRO1957
    see all
  • Function
    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115722 at approximately 22.6kDa (3µg).

References

ab115722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up