Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ02045
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMDQNRDGFIDKEDLKDTYASLGKTNV KDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGK GKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITH GEEKEE
    • Molecular weight17 kDa
    • Amino acids1 to 132
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab111638 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.32% Tris-HCl buffer

General Info

  • Alternative names
    • MYL 5
    • MYL5
    • MYL5_HUMAN
    • MyLC 2
    • MyLC-2
    • MYLC2
    • Myosin light chain 5
    • Myosin light chain 5 regulatory
    • Myosin light polypeptide 5
    • Myosin light polypeptide 5 regulatory
    • Myosin regulatory light chain 5
    • Superfast myosin regulatory light chain 2
    see all
  • Tissue specificityExpressed in fetal skeletal muscle and retina.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MYL5 protein images

  • 15% SDS-PAGE analysis of ab111638 (3 µg)

References for Recombinant Human MYL5 protein (ab111638)

ab111638 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"