Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP60660
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCDFTEDQTAEFKEAFQLFDRTGDGKILYS QCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKN KDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVA GHEDSNGCINYEELVRMVLNG
    • Molecular weight19 kDa including tags
    • Amino acids1 to 151
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104753 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 17 kDa myosin light chain
    • ESMLC
    • LC 17
    • LC17
    • LC17 GI
    • LC17 NM
    • LC17A
    • LC17B
    • MLC 3
    • MLC-3
    • MLC1SM
    • MLC3
    • MLC3NM
    • MLC3SM
    • MYL 6
    • MYL6
    • MYL6_HUMAN
    • Myosin light chain 3
    • Myosin light chain 6 alkali smooth muscle and non muscle
    • Myosin light chain A3
    • Myosin light chain alkali 3
    • Myosin light polypeptide 6
    • Myosin light polypeptide 6 alkali smooth muscle and non muscle
    • Smooth muscle and non muscle myosin alkali light chain
    • Smooth muscle and nonmuscle myosin light chain alkali 6
    see all
  • FunctionRegulatory light chain of myosin. Does not bind calcium.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MYL6 protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human MYL6 protein (ab104753)

ab104753 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"