Overview

  • Product name
    Recombinant Human MYL6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCDFTEDQTAEFKEAFQLFDRTGDGKILYS QCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKN KDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVA GHEDSNGCINYEELVRMVLNG
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 151
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104753 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 17 kDa myosin light chain
    • ESMLC
    • LC 17
    • LC17
    • LC17 GI
    • LC17 NM
    • LC17A
    • LC17B
    • MLC 3
    • MLC-3
    • MLC1SM
    • MLC3
    • MLC3NM
    • MLC3SM
    • MYL 6
    • MYL6
    • MYL6_HUMAN
    • Myosin light chain 3
    • Myosin light chain 6 alkali smooth muscle and non muscle
    • Myosin light chain A3
    • Myosin light chain alkali 3
    • Myosin light polypeptide 6
    • Myosin light polypeptide 6 alkali smooth muscle and non muscle
    • Smooth muscle and non muscle myosin alkali light chain
    • Smooth muscle and nonmuscle myosin light chain alkali 6
    see all
  • Function
    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3µg).

References

ab104753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up