Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLK VLGN PKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDK EGNGTVMGAE IRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVR HILSG

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88850 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • 17 kDa myosin light chain
    • ESMLC
    • LC 17
    • LC17
    • LC17 GI
    • LC17 NM
    • LC17A
    • LC17B
    • MLC 3
    • MLC-3
    • MLC1SM
    • MLC3
    • MLC3NM
    • MLC3SM
    • MYL 6
    • MYL6
    • MYL6_HUMAN
    • Myosin light chain 3
    • Myosin light chain 6 alkali smooth muscle and non muscle
    • Myosin light chain A3
    • Myosin light chain alkali 3
    • Myosin light polypeptide 6
    • Myosin light polypeptide 6 alkali smooth muscle and non muscle
    • Smooth muscle and non muscle myosin alkali light chain
    • Smooth muscle and nonmuscle myosin light chain alkali 6
    see all
  • FunctionRegulatory light chain of myosin. Does not bind calcium.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

References for Recombinant Human MYL6 protein (ab88850)

ab88850 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"