Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSK GESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHI KEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTAKYNYEELCAKELSS ATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKL LIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSIV LLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSP LKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFC PCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI
    • Amino acids
      1 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM-023
    • BZF1
    • E3 ubiquitin protein ligase MYLIP
    • E3 ubiquitin-protein ligase MYLIP
    • Idol
    • Inducible degrader of the LDL-receptor
    • Lipoprotein receptor
    • MIR
    • MYLIP
    • MYLIP_HUMAN
    • Myosin regulatory light chain interacting protein
    • PP5242
    see all
  • Function
    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of myosin regulatory light chain (MRLC), LDLR, VLDLR and LRP8. Proteasomal degradation of MRLC leads to inhibit neurite outgrowth in presence of NGF by counteracting the stabilization of MRLC by saposin-like protein (CNPY2/MSAP) and reducing CNPY2-stimulated neurite outgrowth. Acts as a sterol-dependent inhibitor of cellular cholesterol uptake by mediating ubiquitination and subsequent degradation of LDLR.
  • Tissue specificity
    Ubiquitously expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 FERM domain.
    Contains 1 RING-type zinc finger.
  • Developmental stage
    Expressed in fetal tissues and higher levels were detected in placenta and fetal lung.
  • Domain
    The RING domain mediates ubiquitination and the neurite outgrowth inhibitory activity.
  • Post-translational
    modifications
    Autoubiquitinated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153303 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up