Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEK TPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC
    • Amino acids
      161 to 260
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KMLC
    • MLCK
    • MLCK, skeletal/cardiac
    • MLCK2
    • MYLK 2
    • MYLK2
    • MYLK2_HUMAN
    • Myosin light chain kinase 2
    • Myosin light chain kinase 2 skeletal muscle
    • Myosin light chain kinase 2 skeletal/cardiac muscle
    • MYOSIN LIGHT POLYPEPTIDE KINASE
    • Myosin light polypeptide kinase, skeletal/cardiac
    • Skeletal muscle myosin light chain kinase
    • Skeletal myosin light chain kinase
    • skeletal/cardiac muscle
    • skMLCK
    see all
  • Function
    Implicated in the level of global muscle contraction and cardiac function. Phosphorylates a specific serine in the N-terminus of a myosin light chain.
  • Tissue specificity
    Heart and skeletal muscles. Increased expression in the apical tissue compared to the interventricular septal tissue.
  • Involvement in disease
    Defects in MYLK2 are a cause of familial hypertrophic cardiomyopathy (CMH) [MIM:192600]; also designated FHC or HCM. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Colocalizes with phosphorylated myosin light chain (RLCP) at filaments of the myofibrils.
  • Information by UniProt

Images

  • ab164748 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up