Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEF KEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINF TVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDR FSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 169
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109842 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2410014J02Rik
    • DKFZp779C0757
    • DTNB
    • Fast skeletal myosin light chain 2
    • G2
    • HUMMLC2B
    • MGC13450
    • MLC 2
    • MLC2B
    • MLC2F
    • MLRS_HUMAN
    • MRLC2
    • MYL11
    • MYLPF
    • Myosin light polypeptide 2 alkali
    • Myosin regulatory light chain 2
    • skeletal muscle isoform
    see all
  • Tissue specificity
    Expressed in fetal and adult skeletal muscle.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109842 at approximately 21.2kDa (3µg).

References

ab109842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up