Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96A32
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEF KEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINF TVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDR FSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
    • Molecular weight21 kDa including tags
    • Amino acids1 to 169
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab109842 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2410014J02Rik
    • DKFZp779C0757
    • DTNB
    • Fast skeletal myosin light chain 2
    • G2
    • HUMMLC2B
    • MGC13450
    • MLC 2
    • MLC2B
    • MLC2F
    • MLRS_HUMAN
    • MRLC2
    • MYL11
    • MYLPF
    • Myosin light polypeptide 2 alkali
    • Myosin regulatory light chain 2
    • skeletal muscle isoform
    see all
  • Tissue specificityExpressed in fetal and adult skeletal muscle.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MYLPF protein images

  • 15% SDS-PAGE showing ab109842 at approximately 21.2kDa (3µg).

References for Recombinant Human MYLPF protein (ab109842)

ab109842 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"