Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96A32
    • SpeciesHuman
    • SequenceMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDL RDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVI TGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGN VDYKNICYVITHGDAKDQE
    • Molecular weight45 kDa including tags
    • Amino acids1 to 169

Specifications

Our Abpromise guarantee covers the use of ab112412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesab112412 is best use within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 2410014J02Rik
    • DKFZp779C0757
    • DTNB
    • Fast skeletal myosin light chain 2
    • G2
    • HUMMLC2B
    • MGC13450
    • MLC 2
    • MLC2B
    • MLC2F
    • MLRS_HUMAN
    • MRLC2
    • MYL11
    • MYLPF
    • Myosin light polypeptide 2 alkali
    • Myosin regulatory light chain 2
    • skeletal muscle isoform
    see all
  • Tissue specificityExpressed in fetal and adult skeletal muscle.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MYLPF protein images

  • 12.5% SDS-PAGE showing ab112412 stained with Coomassie Blue.

References for Recombinant Human MYLPF protein (ab112412)

ab112412 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"