Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDL RDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVI TGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGN VDYKNICYVITHGDAKDQE
    • Molecular weight
      45 kDa including tags
    • Amino acids
      1 to 169

Specifications

Our Abpromise guarantee covers the use of ab112412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112412 is best use within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 2410014J02Rik
    • DKFZp779C0757
    • DTNB
    • Fast skeletal myosin light chain 2
    • G2
    • HUMMLC2B
    • MGC13450
    • MLC 2
    • MLC2B
    • MLC2F
    • MLRS_HUMAN
    • MRLC2
    • MYL11
    • MYLPF
    • Myosin light polypeptide 2 alkali
    • Myosin regulatory light chain 2
    • skeletal muscle isoform
    see all
  • Tissue specificity
    Expressed in fetal and adult skeletal muscle.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112412 stained with Coomassie Blue.

References

ab112412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up