Overview

  • Product nameRecombinant Human MYO1A protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UBC5
    • SpeciesHuman
    • SequenceSVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQR QLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ
    • Molecular weight37 kDa including tags
    • Amino acids944 to 1043

Specifications

Our Abpromise guarantee covers the use of ab117013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BBM I
    • BBM-I
    • BBMI
    • Brush border myosin I
    • DFNA48
    • MIHC
    • MYHL
    • Myo1a
    • MYO1A_HUMAN
    • Myosin I heavy chain
    • Myosin, heavy polypeptide like (100kD)
    • Myosin-IA
    see all
  • FunctionInvolved in directing the movement of organelles along actin filaments.
  • Involvement in diseaseDefects in MYO1A are the cause of deafness autosomal dominant type 48 (DFNA48) [MIM:607841]. DFNA48 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similaritiesContains 3 IQ domains.
    Contains 1 myosin head-like domain.
  • Information by UniProt

Recombinant Human MYO1A protein images

  • 12.5% SDS-PAGE of ab117013 at approx. 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MYO1A protein (ab117013)

ab117013 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"