Overview

  • Product name
    Recombinant Human MYO1E protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVI RNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
    • Amino acids
      918 to 1014
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FSGS6
    • HuncM-IC
    • MYO1C
    • Myo1e
    • MYO1E variant protein
    • MYO1E_HUMAN
    • Myosin heavy chain myr 3
    • Myosin IC, formerly
    • Myosin IE
    • Myosin-Ic
    • Myr 3
    • Myr3
    • MYR5
    • Unconventional myosin 1E
    • Unconventional myosin Ie
    • Unconventional myosin-Ie
    see all
  • Function
    Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. Binds to membranes containing anionic phospholipids via its tail domain. Required for normal morphology of the glomerular basement membrane, normal development of foot processes by kidney podocytes and normal kidney function. In dendritic cells, may control the movement of class II-containing cytoplasmic vesicles along the actin cytoskeleton by connecting them with the actin network via ARL14EP and ARL14.
  • Tissue specificity
    Expressed in the immune system. In the kidney, predominantly expressed in the glomerulus, including podocytes.
  • Involvement in disease
    Focal segmental glomerulosclerosis 6
  • Sequence similarities
    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.
    Contains 1 IQ domain.
    Contains 1 myosin motor domain.
    Contains 1 SH3 domain.
    Contains 1 TH1 (class I myosin tail homology) domain.
  • Cellular localization
    Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasmic vesicle. Cytoplasmic vesicle, clathrin-coated vesicle. Cell junction. Colocalizes with F-actin (By similarity). In cultured podocytes, it localizes close to and is associated with the cytoplasmic membrane, with enrichment at the lamellipodia tips. Colocalizes with cytoplasmic vesicles, including endocytic clathrin-coated vesicles. Colocalizes with dynamin at cytoplasmic vesicles.
  • Information by UniProt

Images

  • ab158943 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up