Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEM ILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL
    • Amino acids
      1400 to 1490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • deafness, autosomal recessive 30
    • DFNB30
    • Myo3a
    • MYO3A_HUMAN
    • Myosin IIIA
    • Myosin-IIIa
    see all
  • Function
    Probable actin-based motor with a protein kinase activity. Probably plays a role in vision and hearing.
  • Tissue specificity
    Strongest expression in retina, retinal pigment epithelial cells, cochlea and pancreas.
  • Involvement in disease
    Deafness, autosomal recessive, 30
  • Sequence similarities
    In the N-terminal section; belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family.
    Contains 3 IQ domains.
    Contains 1 myosin head-like domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab162708 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up