Overview

  • Product nameRecombinant Human MYO7B protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6PIF6
    • SpeciesHuman
    • SequenceKERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQND RTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT
    • Molecular weight36 kDa including tags
    • Amino acids1500 to 1596

Specifications

Our Abpromise guarantee covers the use of ab117009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686A08248
    • Myo7b
    • MYO7B_HUMAN
    • Myosin-VIIb
  • FunctionMyosins are actin-based motor molecules with ATPase activity. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. May be have a role in the apical membranes of transporting epithelia.
  • Sequence similaritiesContains 2 FERM domains.
    Contains 6 IQ domains.
    Contains 1 myosin head-like domain.
    Contains 3 MyTH4 domains.
    Contains 2 SH3 domains.
  • Cellular localizationApical cell membrane.
  • Information by UniProt

Recombinant Human MYO7B protein images

  • 12.5% SDS-PAGE of ab117009 at approx. 36.30 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MYO7B protein (ab117009)

ab117009 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"