Overview

  • Product name
    Recombinant Human MYO7B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQND RTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1500 to 1596

Specifications

Our Abpromise guarantee covers the use of ab117009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686A08248
    • Myo7b
    • MYO7B_HUMAN
    • Myosin-VIIb
  • Function
    Myosins are actin-based motor molecules with ATPase activity. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. May be have a role in the apical membranes of transporting epithelia.
  • Sequence similarities
    Contains 2 FERM domains.
    Contains 6 IQ domains.
    Contains 1 myosin head-like domain.
    Contains 3 MyTH4 domains.
    Contains 2 SH3 domains.
  • Cellular localization
    Apical cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab117009 at approx. 36.30 kDa.
    Stained with Coomassie Blue.

References

ab117009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up