Recombinant Human Myocilin protein (ab151657)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RTAQLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSVIHNLQRDSSTQR LDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLE TQTRELETAYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRR GQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRILKESP SGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQ ETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSG SLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLA VDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFII CGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPL EKKLFAWDNLNMVTYDIKLSKMV
    • Amino acids
      33 to 504
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names
    • GLC1A
    • GPOA
    • JOAG
    • JOAG1
    • Mutated trabecular meshwork-induced glucocorticoid response protein
    • MYOC
    • MYOC_HUMAN
    • Myocilin
    • Myocilin, trabecular meshwork inducible glucocorticoid
    • TIGR
    • Trabecular meshwork induced glucocorticoid response protein
    • Trabecular meshwork-induced glucocorticoid response protein
    see all
  • Function
    May participate in the obstruction of fluid outflow in the trabecular meshwork.
  • Tissue specificity
    Expressed in large amounts in various types of muscle, ciliary body, papillary sphincter, skeletal muscle, heart and other tissues. Expressed predominantly in the retina. In normal eyes, found in the inner uveal meshwork region and the anterior portion of the meshwork. In contrast, in many glaucomatous eyes, it is found in more regions of the meshwork and appeared more intensively than in normal eyes, regardless of the type or clinical severity of glaucoma.
  • Involvement in disease
    Defects in MYOC are the cause of primary open angle glaucoma type 1A (GLC1A) [MIM:137750]. Primary open angle glaucoma (POAG) is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place.
    Defects in MYOC may also contribute to primary congenital glaucoma type 3A (GLC3A) [MIM:231300]. Defects in MYOC may contribute to this phenotype via digenic inheritance. GLC3A is an autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early choldhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor.
  • Sequence similarities
    Contains 1 olfactomedin-like domain.
  • Post-translational
    modifications
    Different isoforms may arise by post-translational modifications.
    Glycosylated.
    Palmitoylated.
  • Cellular localization
    Rough endoplasmic reticulum. Secreted. Cell projection > cilium. Located preferentially in the ciliary rootlet and basal body of the connecting cilium of photoreceptor cells, and in the rough endoplasmic reticulum. Also secreted.
  • Information by UniProt

References

ab151657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up