Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERIS TESPAAPALLLADVPSESPPRRQEA AAPSEGESSGDPTQSPDAAPQCP AGANPNPIYQVL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      211 to 320

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHc1
    • Class C basic helix-loop-helix protein 1
    • MYF 3
    • Myf-3
    • MYF3
    • Myoblast determination protein 1
    • MYOD
    • Myod 1
    • MYOD1
    • MYOD1_HUMAN
    • Myogenic differentiation 1
    • Myogenic factor 3
    • Myogenic factor MYF 3
    • Myogenin D1
    • PUM
    see all
  • Function
    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates muscle-specific promoters. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications
    Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function.
    Ubiquitinated on the N-terminus; which is required for proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114214 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up