Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERIS TESPAAPALLLADVPSESPPRRQEA AAPSEGESSGDPTQSPDAAPQCP AGANPNPIYQVL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      211 to 320

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHc1
    • Class C basic helix-loop-helix protein 1
    • MYF 3
    • Myf-3
    • MYF3
    • Myoblast determination protein 1
    • MYOD
    • Myod 1
    • MYOD1
    • MYOD1_HUMAN
    • Myogenic differentiation 1
    • Myogenic factor 3
    • Myogenic factor MYF 3
    • Myogenin D1
    • PUM
    see all
  • Function
    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates muscle-specific promoters. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications
    Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function.
    Ubiquitinated on the N-terminus; which is required for proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human MyoD1 protein images

  • ab114214 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MyoD1 protein (ab114214)

ab114214 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up