Recombinant Human Myogenin protein (ab114244)

Overview

  • Product name
    Recombinant Human Myogenin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPL EDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEA FEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRG GGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 224

Specifications

Our Abpromise guarantee covers the use of ab114244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHc3
    • cb553
    • Class C basic helix-loop-helix protein 3
    • MYF 4
    • Myf-4
    • MYF4
    • MYOG
    • MYOG_HUMAN
    • Myogenic factor 4
    • Myogenic factor 4 myogenin
    • Myogenin
    • Myogenin myogenin factor 4
    • OTTHUMP00000039094
    see all
  • Function
    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human Myogenin protein images

  • 12.5% SDS-PAGE showing ab114244 at approximately 50.75kDa stained with Coomassie Blue.

References for Recombinant Human Myogenin protein (ab114244)

ab114244 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up