Recombinant Human Myogenin protein (ab114244)

Overview

  • Product nameRecombinant Human Myogenin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15173
    • SpeciesHuman
    • SequenceMELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPL EDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEA FEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRG GGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN
    • Molecular weight51 kDa including tags
    • Amino acids1 to 224

Specifications

Our Abpromise guarantee covers the use of ab114244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHc3
    • cb553
    • Class C basic helix-loop-helix protein 3
    • MYF 4
    • Myf-4
    • MYF4
    • MYOG
    • MYOG_HUMAN
    • Myogenic factor 4
    • Myogenic factor 4 myogenin
    • Myogenin
    • Myogenin myogenin factor 4
    • OTTHUMP00000039094
    see all
  • FunctionInvolved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Myogenin protein images

  • 12.5% SDS-PAGE showing ab114244 at approximately 50.75kDa stained with Coomassie Blue.

References for Recombinant Human Myogenin protein (ab114244)

ab114244 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"