Recombinant Human Myosin IIIB protein (ab165456)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMH TRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD
    • Amino acids
      280 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A430065P19Rik
    • Myo3b
    • MYO3B_HUMAN
    • Myosin IIIB
    • Myosin-IIIB
    • RGD1560313
    • RP23-337L20.2
    see all
  • Function
    Probable actin-based motor with a protein kinase activity.
  • Tissue specificity
    Expressed in retina, kidney and testis.
  • Sequence similarities
    In the N-terminal section; belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family.
    Contains 2 IQ domains.
    Contains 1 myosin head-like domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab165456 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up