Recombinant Human Myosin IXA protein (ab116963)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionB2RTY4
    • SpeciesHuman
    • SequenceGKRNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYS ITRKNPRTPLSDLQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLL DKDGIFANST
    • Molecular weight38 kDa including tags
    • Amino acids719 to 828

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4732465J09Rik
    • C130068I12Rik
    • C230003M11
    • FLJ11061
    • FLJ13244
    • MGC71859
    • Myo9a
    • MYO9A variant protein
    • MYO9A_HUMAN
    • Myosin-IXa
    • MYR7
    • Unconventional myosin 9a
    • Unconventional myosin-9a
    see all
  • FunctionMyosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function.
  • Tissue specificityFound to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis.
  • Sequence similaritiesContains 5 IQ domains.
    Contains 2 myosin head-like domains.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 Ras-associating domain.
    Contains 1 Rho-GAP domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Myosin IXA protein images

  • 12.5% SDS-PAGE showing ab116963 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human Myosin IXA protein (ab116963)

ab116963 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"