Recombinant Human Myosin Light Chain 2 protein (ab117178)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP10916
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSMFEQTQIQEFK EAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFT VFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERF SKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
    • Molecular weight21 kDa including tags
    • Amino acids1 to 166
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117178 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesab117178 although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 20% Glycerol, 0.05% Calcium chloride

General Info

  • Alternative names
    • Cardiac myosin light chain-2
    • Cardiac ventricular myosin light chain 2
    • CMH10
    • MLC 2v
    • MLC-2
    • MLC-2v
    • MLC2
    • MLRV_HUMAN
    • MYL 2
    • MYL2
    • Myosin light chain 2 regulatory cardiac slow
    • Myosin light polypeptide 2 regulatory cardiac slow
    • Myosin regulatory light chain 2
    • Myosin regulatory light chain 2 ventricular/cardiac muscle isoform
    • Regulatory light chain of myosin
    • RLC of myosin
    • Slow cardiac myosin regulatory light chain 2
    • ventricular/cardiac muscle isoform
    see all
  • Involvement in diseaseDefects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10) [MIM:608758]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2) [MIM:608758]. MVC2 is a very rare variant of familial hypertrophic cardiomyopathy, characterized by mid-left ventricular chamber thickening.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Post-translational
    modifications
    N-terminus is methylated by METTL11A/NTM1.
  • Information by UniProt

References for Recombinant Human Myosin Light Chain 2 protein (ab117178)

ab117178 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"