Recombinant Human Myosin light chain 3 protein (ab158938)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRAL GQNPTQAEVLRVLGKPRQEELNT
    • Amino acids
      34 to 106
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cardiac myosin light chain 1
    • CMH8
    • CMLC1
    • ELC of myosin
    • Essential light chain of myosin
    • MLC1SB
    • MLC1V
    • MYL3
    • MYL3_HUMAN
    • Myosin light chain 1
    • Myosin light chain 1 slow twitch muscle B/ventricular isoform
    • Myosin light chain 1 slow, B
    • Myosin light chain 3
    • Myosin, light chain 1, ventricular
    • myosin, light chain 3, alkali; ventricular, skeletal, slow
    • myosin, light polypeptide 3, alkali
    • myosin, light polypeptide 3, alkali; ventricular, skeletal, slow
    • OTTHUMP00000165922
    • Slow skeletal ventricular myosin alkali light chain 3
    • slow-twitch muscle B/ventricular isoform
    • Ventricular/slow twitch myosin alkali light chain
    • VLC1
    see all
  • Function
    Regulatory light chain of myosin. Does not bind calcium.
  • Involvement in disease
    Defects in MYL3 are the cause of cardiomyopathy familial hypertrophic type 8 (CMH8) [MIM:608751]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. CMH8 inheritance can be autosomal dominant or recessive.
    Defects in MYL3 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 1 (MVC1) [MIM:608751]. MVC1 is a very rare variant of familial hypertrophic cardiomyopathy, characterized by mid-left ventricular chamber thickening.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
    N-terminus is methylated by METTL11A/NTM1.
  • Information by UniProt

Images

  • ab158938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up