Recombinant Human Myosin light chain kinase protein (ab152553)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLS SMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1710 to 1809

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • deglutamylated form
    • DKFZp686I10125
    • EC 2.7.11.18
    • FLJ12216
    • Kinase related protein
    • Kinase-related protein
    • KRP
    • MLCK
    • MLCK1
    • MLCK108
    • MLCK210
    • MSTP083
    • MYLK
    • MYLK_HUMAN
    • MYLK1
    • Myosin light chain kinase
    • Myosin light polypeptide kinase
    • OTTHUMP00000180642
    • OTTHUMP00000180643
    • smMLCK
    • smooth muscle
    • Smooth muscle myosin light chain kinase
    • Telokin
    see all
  • Function
    Calcium/calmodulin-dependent enzyme implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activty (By similarity). Implicated in the regulation of endothelial as well as vascular permeability. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis.
  • Tissue specificity
    Smooth muscle and non-muscle isozymes are expressed in a wide variety of adult and fetal tissues and in cultured endothelium with qualitative expression appearing to be neither tissue- nor development-specific. Non-muscle isoform 2 is the dominant splice variant expressed in various tissues. Telokin has been found in a wide variety of adult and fetal tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 fibronectin type-III domain.
    Contains 9 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    MLCK is probably down-regulated by phosphorylation.
    The C-terminus is deglutamylated by AGTPBP1/ CCP1, AGBL1/CCP4 and AGBL4/CCP6, leading to the formation of Myosin light chain kinase, smooth muscle, deglutamylated form. The consequences of C-terminal deglutamylation are unknown.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152553 stained with Coomassie Blue.

References

ab152553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up