Recombinant Human Myosin VIIa protein (ab152555)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYF HITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      2118 to 2213

Specifications

Our Abpromise guarantee covers the use of ab152555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deafness autosomal dominant 11
    • Deafness autosomal recessive 2
    • DFNA11
    • DFNB 2
    • DFNB2
    • Myo7a
    • Myosin 7a
    • Myosin VIIa
    • Myosin VIIA (Usher syndrome 1B (autosomal recessive, severe))
    • Myosin, unconventional, family VII, member A
    • MYOVIIA
    • MYU7A
    • NSRD 2
    • NSRD2
    • Unconventional myosin VIIa
    • Ush 1B
    • Ush1b
    • Usher syndrome 1B
    see all
  • Relevance
    Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. In retina, myosin VIIa may play a role in trafficking of ribbon-synaptic vesicle complexes and renewal of the outer photoreceptors disks. In inner ear, it may maintain the rigidity of stereocilia during the dynamic movements of the bundle.
  • Cellular localization
    Cytoplasmic, cytoskeleton

Images

  • 12.5% SDS-PAGE analysis of ab152555 stained with Coomassie Blue.

References

ab152555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up