Recombinant Human Myotrophin protein (ab101086)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCDKEFMWALKNGDLDEVKDYVAKGEDVNR TLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH VSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 118
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101086 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • FLJ31098
    • FLJ99857
    • GCDP
    • Granule cell differentiation protein
    • mtpn
    • MTPN_HUMAN
    • Myotrophin
    • Protein V 1
    • Protein V-1
    • V 1
    see all
  • Function
    Potential role in cerebellar morphogenesis. May function in differentiation of cerebellar neurons, particularly of granule cells. Seems to be associated with cardiac hypertrophy.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the myotrophin family.
    Contains 3 ANK repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Myotrophin protein images

  • 15% SDS-PAGE analysis of ab101086 (3 µg).

References for Recombinant Human Myotrophin protein (ab101086)

ab101086 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up