Recombinant Human Myotrophin protein (ab101086)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP58546
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCDKEFMWALKNGDLDEVKDYVAKGEDVNR TLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH VSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
    • Molecular weight15 kDa including tags
    • Amino acids1 to 118
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101086 was purified by using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • FLJ31098
    • FLJ99857
    • GCDP
    • Granule cell differentiation protein
    • mtpn
    • MTPN_HUMAN
    • Myotrophin
    • Protein V 1
    • Protein V-1
    • V 1
    see all
  • FunctionPotential role in cerebellar morphogenesis. May function in differentiation of cerebellar neurons, particularly of granule cells. Seems to be associated with cardiac hypertrophy.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the myotrophin family.
    Contains 3 ANK repeats.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Myotrophin protein images

  • 15% SDS-PAGE analysis of ab101086 (3 µg).

References for Recombinant Human Myotrophin protein (ab101086)

ab101086 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"