Recombinant Human N Cadherin protein (ab112268)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLL VFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      807 to 906
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Peptide Array

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • CADH2_HUMAN
    • Cadherin 2
    • Cadherin 2 N cadherin neuronal
    • Cadherin 2 type 1
    • Cadherin 2 type 1 N cadherin neuronal
    • Cadherin 2, type 1, N-cadherin (neuronal)
    • Cadherin-2
    • Cadherin2
    • Calcium dependent adhesion protein neuronal
    • CD325
    • CD325 antigen
    • CDH2
    • CDHN
    • CDw325
    • CDw325 antigen
    • N cadherin 1
    • N-cadherin
    • NCAD
    • Neural cadherin
    • OTTHUMP00000066304
    • OTTHUMP00000067378
    see all
  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human N Cadherin protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human N Cadherin protein (ab112268)

ab112268 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up