Recombinant Human N Cadherin protein (ab112268)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLL VFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      807 to 906
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    Peptide Array

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • CADH2_HUMAN
    • Cadherin 2
    • Cadherin 2 N cadherin neuronal
    • Cadherin 2 type 1
    • Cadherin 2 type 1 N cadherin neuronal
    • Cadherin 2, type 1, N-cadherin (neuronal)
    • Cadherin-2
    • Cadherin2
    • Calcium dependent adhesion protein neuronal
    • CD325
    • CD325 antigen
    • CDH2
    • CDHN
    • CDw325
    • CDw325 antigen
    • N cadherin 1
    • N-cadherin
    • NCAD
    • Neural cadherin
    • OTTHUMP00000066304
    • OTTHUMP00000067378
    see all
  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up