Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP04198
    • SpeciesHuman
    • SequenceMPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIW KKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG GLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKR EPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHK ALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSS FLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC
    • Molecular weight77 kDa
    • Amino acids1 to 464
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe37
    • Class E basic helix-loop-helix protein 37
    • MODED
    • mycn
    • MYCN_HUMAN
    • N myc
    • N myc proto oncogene protein
    • N-myc proto-oncogene protein
    • Neuroblastoma derived v myc avian myelocytomatosis viral related oncogene
    • Neuroblastoma MYC oncogene
    • NMYC
    • NMYC proto oncogene protein
    • ODED
    • Oncogene NMYC
    • pp65/67
    • v myc avian myelocytomatosis viral related oncogene neuroblastoma derived
    • v myc myelocytomatosis viral related oncogene neuroblastoma derived
    see all
  • FunctionMay function as a transcription factor.
  • Involvement in diseaseNote=Amplification of the N-MYC gene is associated with a variety of human tumors, most frequently neuroblastoma, where the level of amplification appears to increase as the tumor progresses.
    Defects in MYCN are the cause of microcephaly-oculo-digito-esophageal-duodenal syndrome (MODED) [MIM:164280]; also known as oculodigitoesophagoduodenal syndrome (ODED). Microcephaly-oculo-digito-esophageal-duodenal syndrome is characterized by variable combinations of esophageal and duodenal atresias, microcephaly, learning disability and limb malformations. Cardiac and renal malformations, vertebral anomalies, and deafness have also been described.
    Defects in MYCN are the cause of microcephaly and digital abnormalities with normal intelligence (MCPHDANI) [MIM:602585].
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stageExpressed during fetal development.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human n-Myc protein images

  • SDS-PAGE analysis of ab114325 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human n-Myc protein (ab114325)

ab114325 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"