Recombinant Human N6AMT2 protein (ab165960)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQL SQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIY IFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECL RKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEF RCYVNYDSGLDCGI
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ESP13
    • N 6 adenine specific DNA methyltransferase 2 (putative)
    • N(6) adenine specific DNA methyltransferase 2
    • N(6)-adenine-specific DNA methyltransferase 2
    • N6AMT2
    • N6MT2_HUMAN
    see all
  • Function
    Putative DNA methyltransferase.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. AML1 family.
  • Information by UniProt

Images

  • ab165960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up