Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLV SHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEA EASRQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      421 to 525

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EGR 1 binding protein 2
    • EGR-1-binding protein 2
    • EGR1 binding protein 2
    • MADER
    • Melanoma associated delayed early response protein
    • Melanoma-associated delayed early response protein
    • MGC75085
    • Nab 2
    • nab2
    • NAB2_HUMAN
    • NGFI A binding protein 2
    • NGFI A binding protein 2 (EGR1 binding protein 2)
    • NGFI-A-binding protein 2
    • Protein MADER
    see all
  • Function
    Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability.
  • Tissue specificity
    Widely expressed at low levels. Highly expressed in melanoma cell lines.
  • Sequence similarities
    Belongs to the NAB family.
  • Domain
    The NAB conserved domain 1 (NCD1) interacts with EGR1 inhibitory domain and mediates multimerization.
    The NAB conserved domain 2 (NCD2) is necessary for transcriptional repression.
  • Cellular localization
    Nucleus. Isoform 2 is not localized to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116846 at approximately 37.18 kDa.

References

ab116846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up