Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLV SHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEA EASRQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      421 to 525

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EGR 1 binding protein 2
    • EGR-1-binding protein 2
    • EGR1 binding protein 2
    • MADER
    • Melanoma associated delayed early response protein
    • Melanoma-associated delayed early response protein
    • MGC75085
    • Nab 2
    • nab2
    • NAB2_HUMAN
    • NGFI A binding protein 2
    • NGFI A binding protein 2 (EGR1 binding protein 2)
    • NGFI-A-binding protein 2
    • Protein MADER
    see all
  • Function
    Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability.
  • Tissue specificity
    Widely expressed at low levels. Highly expressed in melanoma cell lines.
  • Sequence similarities
    Belongs to the NAB family.
  • Domain
    The NAB conserved domain 1 (NCD1) interacts with EGR1 inhibitory domain and mediates multimerization.
    The NAB conserved domain 2 (NCD2) is necessary for transcriptional repression.
  • Cellular localization
    Nucleus. Isoform 2 is not localized to the nucleus.
  • Information by UniProt

Recombinant Human Nab2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116846 at approximately 37.18 kDa.

References for Recombinant Human Nab2 protein (ab116846)

ab116846 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up