Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEE SEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
    • Amino acids
      116 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha NAC like
    • ANAC
    • Hom s 2.01
    • MGC71999
    • NAC alpha like
    • NACA2
    • NACAL
    • nascent polypeptide associated complex alpha polypeptide like
    • Nascent polypeptide associated complex subunit alpha 2
    see all
  • Relevance
    NACA2, Nascent polypeptide associated complex subunit alpha 2, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER) by binding to nascent polypeptide chains as they emerge from the ribosome and blocking their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. NACA2 also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab166299 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up