Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWA IPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNH HDHHDEFCLM
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bex
    • BEX3
    • BEX3_HUMAN
    • Brain expressed X linked 3 (mouse) homolog
    • brain expressed, X-linked 3
    • Brain-expressed X-linked gene 3
    • Brain-expressed X-linked protein 3
    • DXS6984E
    • HGR74
    • Nerve growth factor receptor (TNFRSF16) associated protein 1
    • Nerve growth factor receptor associated protein 1
    • Nerve growth factor receptor-associated protein 1
    • NGFR-associated protein 1
    • NGFRAP1
    • Ovarian granulosa cell 13.0 kDa protein HGR74
    • Ovarian granulosa cell protein
    • ovarian granulosa cell protein (13kD)
    • p75NTR associated cell death executor
    • p75NTR-associated cell death executor
    • Protein BEX3
    see all
  • Function
    May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.
  • Tissue specificity
    Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.
  • Sequence similarities
    Belongs to the BEX family.
  • Domain
    The nuclear export signal is required for export from the nucleus and the interactions with itself and p75NTR/NGFR.
  • Post-translational
    modifications
    Ubiquitinated. Degraded by the proteasome.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the cytoplasm and the nucleus. Associates with replicating mitochondria.
  • Information by UniProt

Images

  • ab162056 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up