Recombinant Human NADPH oxidase 4 protein (ab112414)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9NPH5
    • SpeciesHuman
    • SequenceLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKL LFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
    • Molecular weight37 kDa including tags
    • Amino acids479 to 578

Specifications

Our Abpromise guarantee covers the use of ab112414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityChecker: see comments on ab112406.
  • Applications

    ELISA

    Peptide Array

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest used within three months from the date of receipt Checker: see comments on ab112406.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Kidney oxidase-1
    • Kidney superoxide-producing NADPH oxidase
    • KOX
    • KOX 1
    • Kox-1
    • NADPH
    • NADPH oxidase 4
    • Nox4
    • NOX4_HUMAN
    • Renal NAD(P)H-oxidase
    • RENOX
    see all
  • FunctionConstitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. May produce superoxide in the nucleus and play a role in regulating gene expression upon cell stimulation. Isoform 3 is not functional. Isoform 4 displays an increased activity. Isoform 5 and isoform 6 display reduced activity.
  • Tissue specificityExpressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells.
  • Sequence similaritiesContains 1 FAD-binding FR-type domain.
    Contains 1 ferric oxidoreductase domain.
  • Developmental stageExpressed in fetal kidney and fetal liver.
  • Post-translational
    modifications
    Isoform 3 and isoform 4 are N-glycosylated. Isoform 4 glycosylation is required for its proper function.
  • Cellular localizationEndoplasmic reticulum membrane. Cell membrane. Cell junction > focal adhesion. Nucleus. May localize to plasma membrane and focal adhesions. According to PubMed:15927447, may also localize to the nucleus.
  • Information by UniProt

Recombinant Human NADPH oxidase 4 protein images

  • 12% SDS-PAGE image showing ab112414 at approx 36.63kDa

References for Recombinant Human NADPH oxidase 4 protein (ab112414)

ab112414 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"