Overview

  • Product nameRecombinant Human NAGLU protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP54802
    • SpeciesHuman
    • SequenceYQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQ QHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS
    • Molecular weight37 kDa including tags
    • Amino acids644 to 742

Specifications

Our Abpromise guarantee covers the use of ab114822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha N acetylglucosaminidase
    • alpha N acetylglucosaminidase, lysosomal
    • Alpha-N-acetylglucosaminidase 77 kDa form
    • ANAG
    • ANAG_HUMAN
    • MPS IIIB
    • MPS3B
    • N acetyl alpha glucosaminidase
    • N acetylglucosaminidase, alpha
    • N-acetyl-alpha-glucosaminidase
    • NAG
    • NAGLU
    • UFHSD
    • UFHSD 1
    • UFHSD1
    see all
  • FunctionInvolved in the degradation of heparan sulfate.
  • Tissue specificityLiver, ovary, peripheral blood leukocytes, testis, prostate, spleen, colon, lung, placenta and kidney.
  • Involvement in diseaseDefects in NAGLU are the cause of mucopolysaccharidosis type 3B (MPS3B) [MIM:252920]; also known as Sanfilippo syndrome B. MPS3B is a form of mucopolysaccharidosis type 3, an autosomal recessive lysosomal storage disease due to impaired degradation of heparan sulfate. MPS3 is characterized by severe central nervous system degeneration, but only mild somatic disease. Onset of clinical features usually occurs between 2 and 6 years; severe neurologic degeneration occurs in most patients between 6 and 10 years of age, and death occurs typically during the second or third decade of life.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human NAGLU protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human NAGLU protein (ab114822)

ab114822 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"