Overview

  • Product name
    Recombinant Human NAGS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPW YFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDP
    • Amino acids
      435 to 532
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700120E20Rik
    • AGAS
    • AI415708
    • Amino-acid acetyltransferase
    • ARGA
    • EC 2.3.1.1
    • MGC133025
    • N-acetylglutamate synthase
    • N-acetylglutamate synthase conserved domain form
    • N-acetylglutamate synthase, mitochondrial
    • Nags
    • NAGS_HUMAN
    • RP23-398F7.13
    see all
  • Function
    Plays a role in the regulation of ureagenesis by producing variable amounts of N-acetylglutamate (NAG), thus modulating carbamoylphosphate synthase I (CPSI) activity.
  • Tissue specificity
    Highly expressed in the adult liver, kidney and small intestine. Weakly expressed in the fetal liver, lung, pancreas, placenta, heart and brain tissue.
  • Pathway
    Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4.
  • Involvement in disease
    N-acetylglutamate synthase deficiency
  • Sequence similarities
    Belongs to the acetyltransferase family.
    Contains 1 N-acetyltransferase domain.
  • Post-translational
    modifications
    Probably processed by mitochondrial processing peptidase (MPP). The long form has not yet been isolated.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab165745 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up