Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H9S0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSVDPACPQSLPCFEASDCKESSPMPVICG PEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSA EKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSN ILNLSYKQVKTWFQNQRMKSKRWQ
    • Molecular weight20 kDa including tags
    • Amino acids1 to 154
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109960 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl, 0.02% DTT

General Info

  • Alternative names
    • Embryonic stem cell specific homeobox protein (Nanog)
    • ENK
    • FLJ12581
    • hNanog
    • Homeobox protein NANOG
    • Homeobox transcription factor Nanog
    • homeobox transcription factor Nanog-delta 48
    • NANOG
    • Nanog homeobox
    • NANOG_HUMAN
    see all
  • FunctionTranscription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes (By similarity). Acts as a transcriptional activator or repressor (By similarity). Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3' (By similarity). When overexpressed, promotes cells to enter into S phase and proliferation.
  • Tissue specificityExpressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes.
  • Sequence similaritiesBelongs to the Nanog homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stageExpressed in embryonic stem (ES) and carcinoma (EC) cells. Expressed in inner cell mass (ICM) of the blastocyst and gonocytes between 14 and 19 weeks of gestation (at protein level). Not expressed in oocytes, unfertilized oocytes, 2-16 cell embryos and early morula (at protein level). Expressed in embryonic stem cells (ES). Expression decreases with ES differentiation.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Nanog protein images

  • 15% SDS-PAGE analysis of 3 µg ab109960.

References for Recombinant Human Nanog protein (ab109960)

ab109960 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"